PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00539.1.g00330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 504aa    MW: 55630.6 Da    PI: 5.0229
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00539.1.g00330.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+WT+eEd++l++    +G  +W+++++  g+ R++k+c++rw +yl
  Zmw_sc00539.1.g00330.1.am.mk 14 RGPWTAEEDKKLINFMLTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                                  89******************************99************97 PP

2Myb_DNA-binding51.81.9e-1670111447
                                   S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                    T+ E++ ++d++++lG++ W++Ia++++ gRt++++k++w+++
  Zmw_sc00539.1.g00330.1.am.mk  70 LTAAEEQTIIDLHAELGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                                   5999***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-21563IPR009057Homeodomain-like
PROSITE profilePS5129413.589961IPR017930Myb domain
SuperFamilySSF466895.62E-2711108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.8E-141461IPR001005SANT/Myb domain
CDDcd001675.57E-101661No hitNo description
PROSITE profilePS5129426.362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.1E-2564116IPR009057Homeodomain-like
SMARTSM007175.6E-1566114IPR001005SANT/Myb domain
CDDcd001675.42E-1271112No hitNo description
PfamPF002492.2E-1471111IPR001005SANT/Myb domain
SuperFamilySSF534745.28E-11376498IPR029058Alpha/Beta hydrolase fold
Gene3DG3DSA:3.40.50.18203.1E-17379499IPR029058Alpha/Beta hydrolase fold
PfamPF078594.1E-10389479IPR013094Alpha/beta hydrolase fold-3
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0016787Molecular Functionhydrolase activity
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MGRQPCCDKQ GVKRGPWTAE EDKKLINFML THGRCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGIL TAAEEQTIID LHAELGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPATHQLLT NTVAATSQST TTIETAKSSD TEDAQSLKER CQETMPVPTD SSEQSSRPEQ  180
SKNACSHDLD PVMNWPLEMD LPIEEPWLDF TSSNNDELGI VADPLPSDGA MDWLFDYQDF  240
GVDSSNLADC IIEHDRWPRE AGRNQIIQVV LGREPRVYAA SHSPAPPFQL LTFRTQPGAP  300
PATAPHEHSC RSLQQREDAR GDRTPTMGDA TADLVPPSTK ATNLFMNTVV NPDGTVTRPE  360
VPVVPPTDSP SAPVLSRDPY LGGVERTASE AASEDDGILP LEANDKLWSL ALPVGADRDH  420
EFCNPVKSLA PGAVVDLPRC LVTGNTGDPL VDRQRAFAGW LRDRGVDVVE KTDSKGYHAV  480
ELFVPEKAQE LCAVVREFVF ADDA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ50EX65e-85ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0A9PV631e-132A0A0A9PV63_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563